General Information

  • ID:  hor005241
  • Uniprot ID:  Q07334
  • Protein name:  Islet amyloid polypeptide
  • Gene name:  IAPP
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CNTVTCATQRLANFLIHSSNNFGAIFSPPSVGS
  • Length:  33
  • Propeptide:  MCILKLPIVLLVLSVAVNHLQASPVESHQVEKRKCNTVTCATQRLANFLIHSSNNFGAIFSPPSVGS
  • Signal peptide:  MCILKLPIVLLVLSVAVNHLQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CALCRL
  • Target Unid:  G1T6G0
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  1-6
  • Structure ID:  AF-Q07334-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005241_AF2.pdbhor005241_ESM.pdb

Physical Information

Mass: 402583 Formula: C150H233N43O47S2
Absent amino acids: DEKMWY Common amino acids: S
pI: 8.24 Basic residues: 2
Polar residues: 16 Hydrophobic residues: 12
Hydrophobicity: 25.76 Boman Index: -2982
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 73.94
Instability Index: 2257.58 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.91

Literature

  • PubMed ID:  8462765
  • Title:  Islet amyloid polypeptide in the rabbit and European hare: studies on its relationship to amyloidogenesis.